r2games.com

đź–Ą Status: up
đź•’ Response Time: 0.750 sec
⬅️ Response Code: 200
r2games.com

From January 28, 2021, through the past 2 023 days, the availability of r2games.com has been checked 43 times. As of June 28, 2026, r2games.com responded with a 200 status code and was accessible 43 times out of the total checks that were made. Throughout all evaluations done as of August 13, 2026, r2games.com did not experience any offline periods. As of August 13, 2026, no recorded response had an error status out of all the replies that were received. R2games.com's 0.750 seconds reply on June 28, 2026, contrasted its 0.943 seconds average response time.

4.0
43
Last Updated: June 28, 2026

R2games overview

Domain
r2games.com
Title
Play Free Online Games, MMORPG, Browser Games - R2Games
Description
R2Games delivers the best of free-to-play web games. Join our thriving community of online gaming enthusiasts! No downloads or installations required – play anytime, anywhere!
Keywords
R2Games, R2, Free Online Games, Online Gaming, Play Free Games, MMORPG, ARPG, SLG, Adventure Games, Action Games, Strategy Games, Causal, Multi-Language, Browser Games, Video Games, Titan Revenge, Game of Thrones Winter is Coming, Dark Odyssey, League of Angelsâ… , League of Angelsâ…ˇ, League of Angelsâ…˘, Crystal Saga...
R Site Status Rank
1 788
Search Wikipedia
r2games.com
Alternatives
alternatives to r2games.com
Recently checked
verycd.com

nutritionix.com

Last Updated: July 4, 2026
Status: up
Response Time: 0.282 sec
Response Code: 200

dreamsinavila.tmall.com

Last Updated: June 26, 2026
Status: up
Response Time: 0.001 sec
Response Code: not set

radiosawa.com

Last Updated: April 13, 2026
Status: error
Response Time: 0.088 sec
Response Code: 403

secouchermoinsbete.fr

Last Updated: June 13, 2026
Status: up
Response Time: 1.240 sec
Response Code: 200

carguide.ph

Last Updated: July 7, 2026
Status: up
Response Time: 0.617 sec
Response Code: 200

crashkino.net

Last Updated: July 6, 2026
Status: down
Response Time: — sec
Response Code: —

plginrt-project.com

Last Updated: February 25, 2026
Status: up
Response Time: 0.230 sec
Response Code: 200

R2games.com
status check request map as of August 13, 2026

r2games.com request, June 28, 2026

Country report for r2games.com as of August 13, 2026

Other Countries 100.00%
22:06
SiteTotal ChecksLast Modified
desjardins.comdesjardins.com32January 29, 2021
verycd.comverycd.com44January 28, 2021
r2games.comr2games.com43January 28, 2021
fuskator.comfuskator.com155November 11, 2020
questionablecontent.netquestionablecontent.net51January 28, 2021

Radiosawa.com

R2games.com

General SEO Report

Page TitlePage Title tips for r2games.com: User experience hinges critically on whether a website title accurately mirrors the page's content and promise; a mismatched or misleading title leads to higher bounce rates, frustrates users seeking specific information, and ultimately harms both engagement metrics and overall site credibility and conversion objectives, demanding precise alignment between the title and page reality.
Play Free Online Games, MMORPG, Browser Games - R2Games

Length: 55 characters
Meta DescriptionMeta Description tips for r2games.com: When crafting your meta descriptions, focus on matching user intent by addressing specific questions or problems; include your main keywords naturally to improve rankings and relevance, leading to higher organic traffic and better user experience.
R2Games delivers the best of free-to-play web games. Join our thriving community of online gaming enthusiasts! No downloads or installations required – play anytime, anywhere!

Length: 181 characters
Meta KeywordsMeta Keywords tips for r2games.com: While technically possible in some niche search engines or very old systems, the meta keywords tag offers negligible impact on rankings in the major search engines that drive most online traffic, making it a poor allocation of limited SEO resources.
R2Games, R2, Free Online Games, Online Gaming, Play Free Games, MMORPG, ARPG, SLG, Adventure Games, Action Games, Strategy Games, Causal, Multi-Language, Browser Games, Video Games, Titan Revenge, Game of Thrones Winter is Coming, Dark Odyssey, League of Angelsâ… , League of Angelsâ…ˇ, League of Angelsâ…˘, Crystal Saga...

Count: 47 words
Page ContentPage Content tips for r2games.com: Ensure that every element of the page content directly supports the overall user intent behind their search query, transforming raw data into user-focused narratives that deliver precisely what they were looking for.
Web Page Content Length: 20814 characters
H1 HeadingH1 Heading tips for r2games.com: A well-structured H1 header not only helps search engines understand the primary subject of your page but also contributes significantly to a better semantic structure, improving overall page ranking potential.
no h1 heading data for r2games.com
2026-08-13T22:44:26+00:00
H2 HeadingsH2 Headings tips for r2games.com: H2 headers are essential for organizing content into logical groupings, such as steps in a guide, features in a product description, or points in an argument, enhancing both structure and SEO value.
no h2 headings data for r2games.com
2026-08-13T22:44:26+00:00
H3 HeadingsH3 Headings tips for r2games.com: Strategically incorporate long-tail keywords directly within your H3 headers to target specific user search intents, boosting your page's relevance for niche queries and enhancing semantic SEO signals.
Games
Desktop
Premium
HOT & NEW GAMES
FEATURED GAMES
Transferred-Platform Games


Count: 6 heading tag
H4 HeadingsH4 Headings tips for r2games.com: For long-form content, using H4 headers to define subsections and examples makes information easier to skim and digest, directly contributing to higher user satisfaction and lower bounce rates.
no h4 headings data for r2games.com
2026-08-13T22:44:26+00:00
H5-H6 HeadingsH5-H6 Headings tips for r2games.com: Consider the user's scanning behavior; using H3, H4, H5, or H6 HTML header tags appropriately allows visitors to quickly grasp the main points and navigate to the information that matters most to them.
no h5-h6 headings data for r2games.com
2026-08-13T22:44:26+00:00
Image ALT AttributesImage ALT Attributes tips for r2games.com: When optimizing your website for search engines and improving user experience, remember that accurate and relevant Alt text descriptions for images are fundamental, directly impacting SEO rankings for image-related searches.
https://r2cdn2.r2games.com/uploads/games/msapk_game_h.png
https://r2cdn2.r2games.com/uploads/games/loa_kong_game_h.png
https://r2cdn2.r2games.com/uploads/games/loa_armor_game_h.png


Count: 3 images with ALT attributes
Robots.txtRobots.txt tips for r2games.com: Incorrect robots.txt settings might inadvertently block valuable content from search engines, negatively impacting visibility and organic traffic, so always review and test your directives carefully.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for r2games.com: Differentiate your website's indexing by specifying change frequencies (e.g., always, weekly, monthly) within your XML sitemap's `<changefreq>` tags to provide search engines with valuable context about content update patterns.
no xml sitemap data for r2games.com
2026-08-13T22:44:26+00:00
Page SizePage Size tips for r2games.com: Even seemingly simple pages can become large due to external scripts for analytics, chatbots, or ads; review and optimize third-party code contributions to prevent unexpected bloat in page size.
page size: 20 kb
Response TimeResponse Time tips for r2games.com: Optimizing your database queries, leveraging efficient caching strategies like Redis or Memcached, and minimizing server-side processing will significantly improve your website's response time, a key ranking factor that enhances user engagement and reduces bounce rates.
response time: 0.943 sec
Minify CSSMinify CSS tips for r2games.com: Tools dedicated to CSS minification provide powerful solutions for developers seeking to enhance website performance. Speedy pages resulting from effective minification satisfy search engine ranking algorithms focused on Core Web Vitals, pushing your site forward.
Unminified:
https://r2cdn2.r2games.com/en/www/css/pack/index.css?v=20240620
https://r2cdn2.r2games.com/en/www/css/pack/pre_reg.css
https://r2cdn2.r2games.com/en/www/css/common/media_jquery.css?v=20230828
https://r2cdn2.r2games.com/en/www/css/pack/search.css?v=20240621


included in the page
Minify JavaScriptMinify JavaScript tips for r2games.com: While minifying JavaScript, remember that the core objective is performance; focus diligently on removing all unnecessary characters including whitespace and comments without introducing syntax errors that would defeat the purpose of faster loading, SEO-friendly pages.
Minified:
https://r2cdn2.r2games.com/en/js/language/en.js
https://r2cdn2.r2games.com/en/js/search.js?v=20240906
https://r2cdn2.r2games.com/en/js/home.js?v=20220715
Unminified:
https://r2cdn2.r2games.com/en/js/lib/optiscroll.js?v=20240620
https://r2cdn2.r2games.com/en/js/lib/jquery.js


detected during site scan
Structured DataStructured Data tips for r2games.com: Demonstrating a proactive approach to SEO through the careful selection and implementation of appropriate schema markup types can significantly differentiate your website from competitors in search results, offering enhanced visibility and potentially achieving higher positions in Google's algorithmic rankings and featured snippets.
no structured data data for r2games.com
2026-08-13T22:44:26+00:00
CDN UsageCDN Usage tips for r2games.com: Select a CDN provider offering robust HTTP/3 support (QUIC protocol) on specific edge links for potentially faster connection establishment and reduced latency for users on high-latency networks, enhancing overall delivery speed.
content is delivered via CDN
SSL certificatesSSL certificates tips for r2games.com: Modern web browsers display prominent visual indicators like the security lock icon, color-coded address bars, or clear messages for sites with valid SSL certificates, helping users instantly identify secure connections, thereby boosting perceived site trustworthiness crucial for effective conversions and SEO.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:149 195
Minimum Daily Visits:174 360
Minimum Daily Page Views:300 188
Minimum Monthly Unique Visitors:4 475 850
Minimum Monthly Visits:5 230 800
Minimum Monthly Page Views:9 005 640
Minimum Yearly Unique Visitors:53 710 200
Minimum Yearly Visits:62 769 600
Minimum Yearly Page Views:108 067 680
Maximum Daily Unique Visitors:188 741
Maximum Daily Visits:201 323
Maximum Daily Page Views:339 733
Maximum Monthly Unique Visitors:5 662 230
Maximum Monthly Visits:6 039 690
Maximum Monthly Page Views:10 191 990
Maximum Yearly Unique Visitors:67 946 760
Maximum Yearly Visits:72 476 280
Maximum Yearly Page Views:122 303 880

Estimated Valuation

Daily Revenue:US$ 216 - 485
Monthly Revenue:US$ 6 480 - 14 550
Yearly Revenue:US$ 77 760 - 174 600

Estimated Worth

Minimum:US$ 116 640
Maximum:US$ 523 800

Similarly Ranked Sites

RankPoints
aircanada.comaircanada.com5 3994 639 670
plaync.complaync.com5 4004 639 669
nchsoftware.comnchsoftware.com5 4014 639 669
desjardins.comdesjardins.com5 4024 639 669
verycd.comverycd.com5 4034 639 668
r2games.comr2games.com5 4044 639 668
fuskator.comfuskator.com5 4054 639 668
questionablecontent.netquestionablecontent.net5 4064 639 667
thumbtack.comthumbtack.com5 4074 639 667
watchmygirlfriend.tvwatchmygirlfriend.tv5 4084 639 667
lever.colever.co5 4094 639 666